PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G285600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 315aa    MW: 35481.1 Da    PI: 6.7921
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G285600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.6e-151459146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                       +g+W +eEde+l+d+vk++G+++W++I ++  + Rt+k+c++rw +
  Aqcoe1G285600.1.p 14 KGPWMAEEDEILIDYVKKHGPRDWSSIRSKGLLLRTGKSCRLRWVN 59
                       79*************************8887799**********87 PP

2Myb_DNA-binding40.75.5e-1370109344
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                        ++++eE+   +d+ +++G++ W++Ia +++ gRt++++k++w
  Aqcoe1G285600.1.p  70 KFSAEEERVVIDLQARFGNK-WARIATYLQ-GRTDNDVKNFW 109
                        79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.736965IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-201262IPR009057Homeodomain-like
SMARTSM007173.3E-121363IPR001005SANT/Myb domain
SuperFamilySSF466895.86E-2713109IPR009057Homeodomain-like
PfamPF002493.1E-131459IPR001005SANT/Myb domain
CDDcd001677.14E-131661No hitNo description
Gene3DG3DSA:1.10.10.602.9E-1763115IPR009057Homeodomain-like
PROSITE profilePS5129416.96266117IPR017930Myb domain
SMARTSM007172.4E-1067115IPR001005SANT/Myb domain
CDDcd001672.46E-970109No hitNo description
PfamPF002492.5E-1170109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MERRRREEDI VIRKGPWMAE EDEILIDYVK KHGPRDWSSI RSKGLLLRTG KSCRLRWVNK  60
LKPDLKTGCK FSAEEERVVI DLQARFGNKW ARIATYLQGR TDNDVKNFWS SRQKRLARIL  120
QTSNQPKSQR NNGKAPAASH HVATLEAPRP LSTAMEQISS QSQSCQLSYL ENSDVIKMVP  180
LPDLMNPGGL LSLETNLPQL EFTPTEKKPC IDPQPHFSFQ LPQPTLDVQL LPESQDLVLG  240
LGDSNLMDMF GHQETPGLDR GSHSVNAPFL GLRGSSRNGG KGDSDNPATP DSFFEDFPID  300
MFDYIESFPS SSDW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261211525126MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
116ERRRRE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010259182.11e-120PREDICTED: myb-related protein 305-like
TrEMBLA0A061DVG41e-110A0A061DVG4_THECC; Myb-like HTH transcriptional regulator family protein, putative
STRINGVIT_15s0021g02040.t011e-107(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-66MYB family protein